SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0E1Z6N5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0E1Z6N5
Domain Number 1 Region: 40-165
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 2.49e-16
Family SMI1/KNR4-like 0.0079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0E1Z6N5
Sequence length 203
Comment (tr|A0A0E1Z6N5|A0A0E1Z6N5_9FLAO) Uncharacterized protein {ECO:0000313|EMBL:EHO08463.1} KW=Complete proteome OX=883150 OS=Myroides odoratimimus CCUG 10230. GN=HMPREF9712_02125 OC=Flavobacteriaceae; Myroides.
Sequence
MTTLCIDKKEDIIIPFIRIGDPLWEDKTRLIIESLADNWSNDLADPKSEEEIRLLEARIA
TSLPNSLKEFYKVFGVADIGEQLISFDEIDYLGKIWEPHPEYGPSFTQEDLSVLPYLITF
SDYLGNGNMFCFHKETKEIYYFDHDSQPYLTKMFSHFDDYLKGCLVFAQADLFGEVGQDQ
VDQWTEQIVDELIGEDLVRKWRY
Download sequence
Identical sequences A0A0E1Z6N5
WP_006258939.1.29191 WP_006258939.1.38574 WP_006258939.1.65817 WP_006258939.1.86079 WP_006258939.1.93699

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]