SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0E1Z8C6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0E1Z8C6
Domain Number 1 Region: 3-138
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.000000000641
Family SMI1/KNR4-like 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0E1Z8C6
Sequence length 229
Comment (tr|A0A0E1Z8C6|A0A0E1Z8C6_9FLAO) Uncharacterized protein {ECO:0000313|EMBL:EHO10340.1} KW=Complete proteome OX=883150 OS=Myroides odoratimimus CCUG 10230. GN=HMPREF9712_01445 OC=Flavobacteriaceae; Myroides.
Sequence
MTITELEQKYNIVYPELYKQLEKDNMLEVGEYSSMWYATTFPKLKDNPPLLLFSDDFELT
PLKDVDEDIAWLRDPDNYMEIKEEYNFISFAKNGAGDMYCFMMNEEVDGDYPIVYVWHDD
IEATYEAKNLRDFIFKRIVMDMSQLDTYNNQSDQEFIENLRATLKTHIQYLSEDKVALLQ
ELIERPIIDYRLEDTNDKYRGLLTYTEYKEILAKYIPYEKMNVSFPYSE
Download sequence
Identical sequences A0A0E1Z8C6 A0A0S7EJP5
WP_006258207.1.38574 WP_006258207.1.46351 WP_006258207.1.65817 WP_006258207.1.86079 WP_006258207.1.93699

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]