SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0E1Z8G5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0E1Z8G5
Domain Number 1 Region: 34-150
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.00000000209
Family SMI1/KNR4-like 0.009
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0E1Z8G5
Sequence length 186
Comment (tr|A0A0E1Z8G5|A0A0E1Z8G5_9FLAO) Uncharacterized protein {ECO:0000313|EMBL:EHO10381.1} KW=Complete proteome OX=883150 OS=Myroides odoratimimus CCUG 10230. GN=HMPREF9712_01486 OC=Flavobacteriaceae; Myroides.
Sequence
MRLFEIEEVSVFLEKKFADVDKDIISELLLIPYKGSKEEVLRLKEYLNITILPEEFEDFI
MRYNLGNLTLANIQFGSGGNYINRLINLNNKDNYWYQDCLSIDAMVVGLGDPYTILLSLK
EGVVYVVSSEISFDDKVIVAPSFDSFIQGLGTSIYAKASGREESFLSLIENKFGVNTRFF
WEEILY
Download sequence
Identical sequences A0A0E1Z8G5 A0A0S7EGX1
WP_006258252.1.29191 WP_006258252.1.46351 WP_006258252.1.65817 WP_006258252.1.93699

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]