SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0E1ZA24 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0E1ZA24
Domain Number 1 Region: 124-180,241-290
Classification Level Classification E-value
Superfamily ARM repeat 0.00000155
Family GUN4-associated domain 0.068
Further Details:      
 
Domain Number 2 Region: 21-90
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.000051
Family SMI1/KNR4-like 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0E1ZA24
Sequence length 335
Comment (tr|A0A0E1ZA24|A0A0E1ZA24_9FLAO) Uncharacterized protein {ECO:0000313|EMBL:EHO09652.1} KW=Complete proteome OX=883150 OS=Myroides odoratimimus CCUG 10230. GN=HMPREF9712_01634 OC=Flavobacteriaceae; Myroides.
Sequence
MTKEEWEALTFALQEDDLSDEDYYEIQNKLFSGLLAIGTQGCAITTCLVMNGEHRGRIVY
INEDYQPSFAYEAHFLDWYERWLDEIISGELVSKDAGWFGYARGGSSEALWESFKTIEDK
EEKLEYLVGLMRKKEISEAILQEIEYVLSEECDDDIRSSLTMILAKVAFTRAIPFIKELI
GQNLLVSLKTIHWYAEDKAYWLPFITPLSDTIDEEETFRFYTYVVSKATDDYGDYILVGL
QSANQAIRATAIYTLGEAKNKKNYLNQFIKCLYDDDERVVLYALQGLKEVNDERLLACYK
VVYKKYKDSEEENYIIVNLEHRLKELGLSLEELER
Download sequence
Identical sequences A0A0E1ZA24

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]