SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0E1ZAY1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0E1ZAY1
Domain Number 1 Region: 47-108
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.0000523
Family SMI1/KNR4-like 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0E1ZAY1
Sequence length 155
Comment (tr|A0A0E1ZAY1|A0A0E1ZAY1_9FLAO) Uncharacterized protein {ECO:0000313|EMBL:EHO11972.1} KW=Complete proteome OX=883150 OS=Myroides odoratimimus CCUG 10230. GN=HMPREF9712_00219 OC=Flavobacteriaceae; Myroides.
Sequence
MKFPKAITDFIAKEIECTHYFMPQFYPQQGDIEGFQDGYKYNSVEGKDITGTKEGDFHPN
WYVICGGYAQDPYWIDITKEEKGFPVYFAEHGAGKWEPLLVADSLGEFEECVKYMIYLTE
SELSKEEIERLYNERFDLDSPFWELVWSEFSFDEE
Download sequence
Identical sequences A0A0E1ZAY1 A0A0S7EEI6
WP_006256926.1.24692 WP_006256926.1.46351 WP_006256926.1.65817 WP_006256926.1.93699

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]