SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0E1ZV80 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A0E1ZV80
Domain Number - Region: 86-113
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.0412
Family SMI1/KNR4-like 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0E1ZV80
Sequence length 178
Comment (tr|A0A0E1ZV80|A0A0E1ZV80_CAMJU) Uncharacterized protein {ECO:0000313|EMBL:EIB52671.1} KW=Complete proteome OX=889253 OS=Campylobacter jejuni subsp. jejuni 2008-988. GN=cje154_08194 OC=Campylobacteraceae; Campylobacter.
Sequence
MSDFLSFTLENIRNGGAFMAWLESRRLEWAPLMAARLKYLLEGRTFVLMCDEQRSWYEEY
FLKNINSKATRPMLPFVSLNSLCKKKVQSSEDIALLNDLLDISFPNGYVYFYIGSASDNK
SLIAKSRDDSLLWLFDEQLQDSFYLNSKDKDLDIKLISLYQLFDVSLDAILFSKVQLG
Download sequence
Identical sequences A0A059HVU6 A0A0B6U1I8 A0A0E1ZV80 A0A1E7PEQ6 A5KFB8 Q0PAT4
gi|543946016|ref|YP_008538520.1| gi|544062251|ref|YP_008561956.1| gi|403055357|ref|YP_006632762.1| gi|543947790|ref|YP_008540191.1| WP_002852154.1.100358 WP_002852154.1.100416 WP_002852154.1.100636 WP_002852154.1.100792 WP_002852154.1.100842 WP_002852154.1.100968 WP_002852154.1.101016 WP_002852154.1.101230 WP_002852154.1.101242 WP_002852154.1.101273 WP_002852154.1.101346 WP_002852154.1.101664 WP_002852154.1.101723 WP_002852154.1.101807 WP_002852154.1.101886 WP_002852154.1.10254 WP_002852154.1.10356 WP_002852154.1.10462 WP_002852154.1.10699 WP_002852154.1.10881 WP_002852154.1.11065 WP_002852154.1.1129 WP_002852154.1.11331 WP_002852154.1.11336 WP_002852154.1.11471 WP_002852154.1.11684 WP_002852154.1.1235 WP_002852154.1.1256 WP_002852154.1.1269 WP_002852154.1.12799 WP_002852154.1.13240 WP_002852154.1.13372 WP_002852154.1.13519 WP_002852154.1.13562 WP_002852154.1.1376 WP_002852154.1.13832 WP_002852154.1.14014 WP_002852154.1.14405 WP_002852154.1.14742 WP_002852154.1.14781 WP_002852154.1.15188 WP_002852154.1.154 WP_002852154.1.16187 WP_002852154.1.16324 WP_002852154.1.16820 WP_002852154.1.17095 WP_002852154.1.17171 WP_002852154.1.17462 WP_002852154.1.17486 WP_002852154.1.17852 WP_002852154.1.17970 WP_002852154.1.18051 WP_002852154.1.18219 WP_002852154.1.18221 WP_002852154.1.18252 WP_002852154.1.18253 WP_002852154.1.1828 WP_002852154.1.18520 WP_002852154.1.18713 WP_002852154.1.19041 WP_002852154.1.19078 WP_002852154.1.19191 WP_002852154.1.19202 WP_002852154.1.19381 WP_002852154.1.19580 WP_002852154.1.20077 WP_002852154.1.20285 WP_002852154.1.20292 WP_002852154.1.20333 WP_002852154.1.20645 WP_002852154.1.208 WP_002852154.1.20879 WP_002852154.1.20956 WP_002852154.1.21363 WP_002852154.1.21475 WP_002852154.1.21512 WP_002852154.1.21754 WP_002852154.1.21770 WP_002852154.1.21805 WP_002852154.1.21857 WP_002852154.1.21897 WP_002852154.1.22192 WP_002852154.1.22321 WP_002852154.1.22810 WP_002852154.1.23143 WP_002852154.1.23248 WP_002852154.1.23465 WP_002852154.1.23610 WP_002852154.1.24438 WP_002852154.1.24539 WP_002852154.1.24558 WP_002852154.1.24671 WP_002852154.1.24675 WP_002852154.1.24698 WP_002852154.1.24720 WP_002852154.1.24785 WP_002852154.1.24786 WP_002852154.1.24806 WP_002852154.1.25373 WP_002852154.1.25665 WP_002852154.1.26221 WP_002852154.1.26458 WP_002852154.1.26505 WP_002852154.1.26708 WP_002852154.1.27100 WP_002852154.1.27433 WP_002852154.1.27444 WP_002852154.1.27710 WP_002852154.1.27906 WP_002852154.1.2792 WP_002852154.1.2807 WP_002852154.1.28240 WP_002852154.1.28285 WP_002852154.1.2843 WP_002852154.1.28518 WP_002852154.1.28896 WP_002852154.1.29524 WP_002852154.1.2958 WP_002852154.1.29637 WP_002852154.1.29837 WP_002852154.1.29911 WP_002852154.1.30041 WP_002852154.1.30441 WP_002852154.1.30484 WP_002852154.1.30486 WP_002852154.1.3062 WP_002852154.1.30663 WP_002852154.1.30838 WP_002852154.1.31398 WP_002852154.1.31607 WP_002852154.1.31617 WP_002852154.1.31676 WP_002852154.1.31747 WP_002852154.1.31864 WP_002852154.1.32427 WP_002852154.1.32452 WP_002852154.1.32513 WP_002852154.1.33249 WP_002852154.1.33256 WP_002852154.1.33317 WP_002852154.1.3366 WP_002852154.1.33739 WP_002852154.1.33742 WP_002852154.1.33997 WP_002852154.1.34283 WP_002852154.1.34433 WP_002852154.1.34488 WP_002852154.1.34552 WP_002852154.1.34823 WP_002852154.1.34957 WP_002852154.1.3501 WP_002852154.1.35038 WP_002852154.1.35226 WP_002852154.1.35241 WP_002852154.1.35293 WP_002852154.1.35324 WP_002852154.1.35952 WP_002852154.1.35997 WP_002852154.1.36032 WP_002852154.1.36407 WP_002852154.1.37327 WP_002852154.1.37418 WP_002852154.1.37639 WP_002852154.1.37646 WP_002852154.1.37823 WP_002852154.1.38219 WP_002852154.1.38315 WP_002852154.1.38495 WP_002852154.1.38714 WP_002852154.1.38899 WP_002852154.1.38948 WP_002852154.1.3900 WP_002852154.1.39618 WP_002852154.1.39640 WP_002852154.1.39743 WP_002852154.1.39750 WP_002852154.1.39810 WP_002852154.1.39893 WP_002852154.1.40511 WP_002852154.1.40807 WP_002852154.1.40896 WP_002852154.1.40907 WP_002852154.1.40919 WP_002852154.1.41150 WP_002852154.1.41164 WP_002852154.1.41380 WP_002852154.1.41408 WP_002852154.1.41410 WP_002852154.1.41421 WP_002852154.1.41544 WP_002852154.1.41619 WP_002852154.1.41745 WP_002852154.1.41766 WP_002852154.1.41840 WP_002852154.1.42543 WP_002852154.1.42609 WP_002852154.1.43183 WP_002852154.1.43217 WP_002852154.1.43574 WP_002852154.1.43628 WP_002852154.1.43760 WP_002852154.1.44039 WP_002852154.1.4421 WP_002852154.1.44221 WP_002852154.1.44298 WP_002852154.1.44383 WP_002852154.1.45151 WP_002852154.1.45391 WP_002852154.1.45438 WP_002852154.1.46004 WP_002852154.1.46176 WP_002852154.1.4658 WP_002852154.1.46763 WP_002852154.1.46808 WP_002852154.1.46943 WP_002852154.1.46988 WP_002852154.1.47196 WP_002852154.1.47343 WP_002852154.1.47446 WP_002852154.1.48021 WP_002852154.1.48271 WP_002852154.1.48314 WP_002852154.1.485 WP_002852154.1.48597 WP_002852154.1.48803 WP_002852154.1.49316 WP_002852154.1.50213 WP_002852154.1.50297 WP_002852154.1.50385 WP_002852154.1.50392 WP_002852154.1.50763 WP_002852154.1.50812 WP_002852154.1.5097 WP_002852154.1.51415 WP_002852154.1.51618 WP_002852154.1.52620 WP_002852154.1.52702 WP_002852154.1.52711 WP_002852154.1.52727 WP_002852154.1.52732 WP_002852154.1.53003 WP_002852154.1.53289 WP_002852154.1.53793 WP_002852154.1.53913 WP_002852154.1.53979 WP_002852154.1.54092 WP_002852154.1.54452 WP_002852154.1.54592 WP_002852154.1.54780 WP_002852154.1.5497 WP_002852154.1.55240 WP_002852154.1.55431 WP_002852154.1.55453 WP_002852154.1.55476 WP_002852154.1.55481 WP_002852154.1.55661 WP_002852154.1.56230 WP_002852154.1.56279 WP_002852154.1.56351 WP_002852154.1.56397 WP_002852154.1.56688 WP_002852154.1.57091 WP_002852154.1.57227 WP_002852154.1.57361 WP_002852154.1.5737 WP_002852154.1.57733 WP_002852154.1.57741 WP_002852154.1.57958 WP_002852154.1.58138 WP_002852154.1.58149 WP_002852154.1.5843 WP_002852154.1.58505 WP_002852154.1.58546 WP_002852154.1.58576 WP_002852154.1.5866 WP_002852154.1.5888 WP_002852154.1.59093 WP_002852154.1.59362 WP_002852154.1.59516 WP_002852154.1.59550 WP_002852154.1.59555 WP_002852154.1.60034 WP_002852154.1.60240 WP_002852154.1.60349 WP_002852154.1.60397 WP_002852154.1.60399 WP_002852154.1.60531 WP_002852154.1.60548 WP_002852154.1.61064 WP_002852154.1.61249 WP_002852154.1.61283 WP_002852154.1.61383 WP_002852154.1.61465 WP_002852154.1.61761 WP_002852154.1.6187 WP_002852154.1.62153 WP_002852154.1.62305 WP_002852154.1.62423 WP_002852154.1.62439 WP_002852154.1.62451 WP_002852154.1.62457 WP_002852154.1.6254 WP_002852154.1.62545 WP_002852154.1.62568 WP_002852154.1.62672 WP_002852154.1.62865 WP_002852154.1.62996 WP_002852154.1.63100 WP_002852154.1.63528 WP_002852154.1.63837 WP_002852154.1.63885 WP_002852154.1.6402 WP_002852154.1.64025 WP_002852154.1.64404 WP_002852154.1.64659 WP_002852154.1.64790 WP_002852154.1.64878 WP_002852154.1.65060 WP_002852154.1.65073 WP_002852154.1.65129 WP_002852154.1.6545 WP_002852154.1.65548 WP_002852154.1.65644 WP_002852154.1.65735 WP_002852154.1.65824 WP_002852154.1.65927 WP_002852154.1.65984 WP_002852154.1.66067 WP_002852154.1.66213 WP_002852154.1.66520 WP_002852154.1.66802 WP_002852154.1.66841 WP_002852154.1.66968 WP_002852154.1.67015 WP_002852154.1.67138 WP_002852154.1.67216 WP_002852154.1.67511 WP_002852154.1.67675 WP_002852154.1.68389 WP_002852154.1.68463 WP_002852154.1.6862 WP_002852154.1.68625 WP_002852154.1.69031 WP_002852154.1.69044 WP_002852154.1.69312 WP_002852154.1.69408 WP_002852154.1.69516 WP_002852154.1.69580 WP_002852154.1.69737 WP_002852154.1.69750 WP_002852154.1.6976 WP_002852154.1.70235 WP_002852154.1.70749 WP_002852154.1.70788 WP_002852154.1.71045 WP_002852154.1.71370 WP_002852154.1.71472 WP_002852154.1.71478 WP_002852154.1.7176 WP_002852154.1.71776 WP_002852154.1.71884 WP_002852154.1.7207 WP_002852154.1.72159 WP_002852154.1.72239 WP_002852154.1.72313 WP_002852154.1.72519 WP_002852154.1.72607 WP_002852154.1.72627 WP_002852154.1.72709 WP_002852154.1.72863 WP_002852154.1.72925 WP_002852154.1.72941 WP_002852154.1.73090 WP_002852154.1.73097 WP_002852154.1.73138 WP_002852154.1.73406 WP_002852154.1.73649 WP_002852154.1.74113 WP_002852154.1.74140 WP_002852154.1.74315 WP_002852154.1.74360 WP_002852154.1.74472 WP_002852154.1.7481 WP_002852154.1.74864 WP_002852154.1.74931 WP_002852154.1.75460 WP_002852154.1.75503 WP_002852154.1.75611 WP_002852154.1.75820 WP_002852154.1.76011 WP_002852154.1.7643 WP_002852154.1.76449 WP_002852154.1.76559 WP_002852154.1.76586 WP_002852154.1.76658 WP_002852154.1.76847 WP_002852154.1.77068 WP_002852154.1.77207 WP_002852154.1.77380 WP_002852154.1.77478 WP_002852154.1.77538 WP_002852154.1.7765 WP_002852154.1.77828 WP_002852154.1.77921 WP_002852154.1.78032 WP_002852154.1.78159 WP_002852154.1.78209 WP_002852154.1.78310 WP_002852154.1.78370 WP_002852154.1.78405 WP_002852154.1.78406 WP_002852154.1.78508 WP_002852154.1.78576 WP_002852154.1.78684 WP_002852154.1.78999 WP_002852154.1.79113 WP_002852154.1.79231 WP_002852154.1.79449 WP_002852154.1.79613 WP_002852154.1.79770 WP_002852154.1.79874 WP_002852154.1.80139 WP_002852154.1.80259 WP_002852154.1.80553 WP_002852154.1.80633 WP_002852154.1.80652 WP_002852154.1.80751 WP_002852154.1.80807 WP_002852154.1.80825 WP_002852154.1.8122 WP_002852154.1.81435 WP_002852154.1.81447 WP_002852154.1.81578 WP_002852154.1.81664 WP_002852154.1.8175 WP_002852154.1.82138 WP_002852154.1.82311 WP_002852154.1.82379 WP_002852154.1.82383 WP_002852154.1.83819 WP_002852154.1.840 WP_002852154.1.84803 WP_002852154.1.84835 WP_002852154.1.8525 WP_002852154.1.85419 WP_002852154.1.85447 WP_002852154.1.85725 WP_002852154.1.86570 WP_002852154.1.86579 WP_002852154.1.87010 WP_002852154.1.87295 WP_002852154.1.87304 WP_002852154.1.87487 WP_002852154.1.87669 WP_002852154.1.87957 WP_002852154.1.88134 WP_002852154.1.88208 WP_002852154.1.88272 WP_002852154.1.88403 WP_002852154.1.8846 WP_002852154.1.88515 WP_002852154.1.88713 WP_002852154.1.88784 WP_002852154.1.88833 WP_002852154.1.88835 WP_002852154.1.88889 WP_002852154.1.89384 WP_002852154.1.89485 WP_002852154.1.89641 WP_002852154.1.89661 WP_002852154.1.89687 WP_002852154.1.90075 WP_002852154.1.90216 WP_002852154.1.90277 WP_002852154.1.90347 WP_002852154.1.90384 WP_002852154.1.90438 WP_002852154.1.9044 WP_002852154.1.90623 WP_002852154.1.90679 WP_002852154.1.90841 WP_002852154.1.91047 WP_002852154.1.91326 WP_002852154.1.91330 WP_002852154.1.91537 WP_002852154.1.91753 WP_002852154.1.9176 WP_002852154.1.92325 WP_002852154.1.92449 WP_002852154.1.92465 WP_002852154.1.92637 WP_002852154.1.92673 WP_002852154.1.92983 WP_002852154.1.93020 WP_002852154.1.93029 WP_002852154.1.93057 WP_002852154.1.93214 WP_002852154.1.93549 WP_002852154.1.93632 WP_002852154.1.9372 WP_002852154.1.93864 WP_002852154.1.9405 WP_002852154.1.94534 WP_002852154.1.94535 WP_002852154.1.94631 WP_002852154.1.94769 WP_002852154.1.95048 WP_002852154.1.95065 WP_002852154.1.95087 WP_002852154.1.95360 WP_002852154.1.95773 WP_002852154.1.9591 WP_002852154.1.96104 WP_002852154.1.96265 WP_002852154.1.96291 WP_002852154.1.96302 WP_002852154.1.96501 WP_002852154.1.96525 WP_002852154.1.96527 WP_002852154.1.96616 WP_002852154.1.96886 WP_002852154.1.97085 WP_002852154.1.97120 WP_002852154.1.97174 WP_002852154.1.97629 WP_002852154.1.9776 WP_002852154.1.97790 WP_002852154.1.97809 WP_002852154.1.97978 WP_002852154.1.98261 WP_002852154.1.98367 WP_002852154.1.98476 WP_002852154.1.98782 WP_002852154.1.98885 WP_002852154.1.99003 WP_002852154.1.99042 WP_002852154.1.99079 WP_002852154.1.99085 WP_002852154.1.99129 WP_002852154.1.9920 WP_002852154.1.9929 WP_002852154.1.99434 WP_002852154.1.99440 WP_002852154.1.99444 WP_002852154.1.99612 WP_002852154.1.99673 WP_002852154.1.99811 WP_002852154.1.99893 YP_002344013.1.54668 192222.Cj0583 gi|543949575|ref|YP_008541919.1| gi|384447862|ref|YP_005655913.1| gi|218562234|ref|YP_002344013.1| gi|407942018|ref|YP_006857660.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]