SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0E2APL5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A0E2APL5
Domain Number - Region: 10-59
Classification Level Classification E-value
Superfamily MAL13P1.257-like 0.000994
Family MAL13P1.257-like 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0E2APL5
Sequence length 60
Comment (tr|A0A0E2APL5|A0A0E2APL5_BACFG) Uncharacterized protein {ECO:0000313|EMBL:EIY96218.1} KW=Complete proteome OX=997883 OS=Bacteroides fragilis CL07T12C05. GN=HMPREF1056_02106 OC=Bacteroides.
Sequence
MIKISADKDADQREIYNKIVLCPICGQKLTDISYVNGVVILRVKCRRCKNYINVDIVGTK
Download sequence
Identical sequences A0A0E2APL5 A0A174EXR9 A0A1C6L102 A0A1E9C3D5 I9QT36 I9R5T8 K9EAW2
WP_005794422.1.1104 WP_005794422.1.11335 WP_005794422.1.36284 WP_005794422.1.39779 WP_005794422.1.54640 WP_005794422.1.57299 WP_005794422.1.67491 WP_005794422.1.72222 WP_005794422.1.76253 WP_005794422.1.82285 WP_005794422.1.89819 WP_005794422.1.94919

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]