SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0E2AY37 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0E2AY37
Domain Number 1 Region: 101-190
Classification Level Classification E-value
Superfamily Translation proteins SH3-like domain 0.00000000193
Family SPT5 KOW domain-like 0.063
Further Details:      
 
Domain Number 2 Region: 20-122
Classification Level Classification E-value
Superfamily N-utilization substance G protein NusG, N-terminal domain 0.00000000301
Family N-utilization substance G protein NusG, N-terminal domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0E2AY37
Sequence length 192
Comment (tr|A0A0E2AY37|A0A0E2AY37_BACFG) Uncharacterized protein {ECO:0000313|EMBL:EIY92728.1} KW=Complete proteome OX=997883 OS=Bacteroides fragilis CL07T12C05. GN=HMPREF1056_03467 OC=Bacteroides.
Sequence
MFHYPGVPQLYPFVNNSINKSWYALRITYSRELAFKEYLDSRGVRNFLPMRYEYVFRGER
KIRKLVPVVHNLVFVYATRSEVDEMKSTVGASLPIRYIMDRETRQPITIPEVQMRSFIAV
AGNYDEQVVYLDPSVVSMKRGDRVRVTGGIFEGVEGEFVRIKGDRRVVVSIQGVMAVATA
FIHPSLIELIKN
Download sequence
Identical sequences A0A0E2AJ72 A0A0E2AY37

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]