SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0E2BDJ3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A0E2BDJ3
Domain Number - Region: 13-41
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.0471
Family SMI1/KNR4-like 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0E2BDJ3
Sequence length 74
Comment (tr|A0A0E2BDJ3|A0A0E2BDJ3_9LEPT) Uncharacterized protein {ECO:0000313|EMBL:EKO33418.1} KW=Complete proteome OX=1049984 OS=Leptospira santarosai str. MOR084. GN=LEP1GSC179_2506 OC=Bacteria; Spirochaetes; Leptospirales; Leptospiraceae; Leptospira.
Sequence
MVINYFKIQPLEITESELDEYEKHLGIPLHKEDREAILKSTEFRRALAIKNKLRLKISTN
RLLQDDSKTMNRNK
Download sequence
Identical sequences A0A0E2BDJ3 A0A0E2DWD6 A0A0M1YTZ1 A0A1V2E8G4 A0A1V2ENY4 K8XW39 M6JJA8 M6Z261
WP_004461895.1.102048 WP_004461895.1.10732 WP_004461895.1.10978 WP_004461895.1.18456 WP_004461895.1.19286 WP_004461895.1.21210 WP_004461895.1.28466 WP_004461895.1.29418 WP_004461895.1.38540 WP_004461895.1.41926 WP_004461895.1.4226 WP_004461895.1.44299 WP_004461895.1.4626 WP_004461895.1.58894 WP_004461895.1.6202 WP_004461895.1.62320 WP_004461895.1.63257 WP_004461895.1.67987 WP_004461895.1.68471 WP_004461895.1.68538 WP_004461895.1.69976 WP_004461895.1.70806 WP_004461895.1.79523 WP_004461895.1.80937 WP_004461895.1.83002 WP_004461895.1.84710 WP_004461895.1.86625 WP_004461895.1.86790 WP_004461895.1.89633 WP_004461895.1.90021 WP_004461895.1.9422

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]