SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0E2BUL4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0E2BUL4
Domain Number 1 Region: 341-506
Classification Level Classification E-value
Superfamily L domain-like 8.26e-18
Family Internalin LRR domain 0.0035
Further Details:      
 
Domain Number 2 Region: 12-67
Classification Level Classification E-value
Superfamily WGR domain-like 0.00000000798
Family WGR domain 0.016
Further Details:      
 
Weak hits

Sequence:  A0A0E2BUL4
Domain Number - Region: 163-256
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.0432
Family SMI1/KNR4-like 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0E2BUL4
Sequence length 523
Comment (tr|A0A0E2BUL4|A0A0E2BUL4_9LEPT) WGR domain protein {ECO:0000313|EMBL:EKO35248.1} KW=Complete proteome OX=1049984 OS=Leptospira santarosai str. MOR084. GN=LEP1GSC179_1982 OC=Bacteria; Spirochaetes; Leptospirales; Leptospiraceae; Leptospira.
Sequence
MKHHLTFKDDKSDKFWNIEVDETSFTVTYGKTGTIGQTQTKSFDDEKKCLKEAEKLLAEK
LKKGYVEGDTLANTKSVDSKKDSEPSNDYLKEWEAIVDAKDIHKALIKHFSYLADNPRFQ
TLLEVVFEKARSVSCNSEALKVTFPKFEMIATPPMQQIPENYPRSYQNLLKKHETIELSE
FQYVLGEHGYFDREVQKIWFEDFHDSEEVDSLILEFAQAENLQCPVCDGTSGNFWIYHPG
KKNSSGEPIIYYLESDGAEMIGDPQPCNAGSVFLKILANSLDMQMAVKEIWSGKKVTDSQ
AWWDNLDSEWKKFLTDSCYRKEDPAAEALALKSLGSHTDINIKTLEPLRPMKLLKRLGLF
TPKISDLSPLIDLKQLIELRIQSKSILDFSSIGKLVKLKELTIIFTESIELDLSWLKNLS
KLNELTIYFKGHEKQIRIQSLDALQSLQSLKKLELMNIRSTTGEKISLEPLSALTELEKL
SLRDFPLRSLEPLYALTSLKEIDLSSSIDRIEIKSRMPWCKIY
Download sequence
Identical sequences A0A0E2BUL4
WP_004475455.1.67987 WP_004475455.1.80937

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]