SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0E2E883 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0E2E883
Domain Number 1 Region: 247-391
Classification Level Classification E-value
Superfamily L domain-like 1.56e-16
Family Internalin LRR domain 0.0052
Further Details:      
 
Weak hits

Sequence:  A0A0E2E883
Domain Number - Region: 84-178
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.0235
Family SMI1/KNR4-like 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0E2E883
Sequence length 416
Comment (tr|A0A0E2E883|A0A0E2E883_9LEPT) Leucine rich repeat protein {ECO:0000313|EMBL:EKS08576.1} KW=Complete proteome OX=1193057 OS=Leptospira santarosai str. JET. GN=LEP1GSC071_3537 OC=Bacteria; Spirochaetes; Leptospirales; Leptospiraceae; Leptospira.
Sequence
MKPSNKNAGLESLEKLASSDNIVKGLAKHFSYLADSPGFELVLEQIMREAKSVEISKQNG
NLIVKFDQDVLTASPPLDKKKLGKWPKGFQNLMEVHGSLTLEEAQLYLGPDGTFESEDLL
EYLDDLEDKQDILGEINADEILSPITDYSDWWLYHPTKKNKEGQPLLFFYSHEGYIKDKK
EYNVGSLFLERLAEQLNIAISLPEEESPQVVSWWQTRPGESNILSFWHSSGDDFPEEFDQ
EPEGDFLKGVTDLFLSRGVRNLNELPLSHFKNLKKLVVCPHKDQIKFPCESLAGIEQLES
LEHFEIYYSKIDDLSPLKELKNLRRLDIGSQHLVDLRPLCGLTTLSVLDIASLALKDVSP
LVVLKGLTHLRLSGCKNLKDVDVLLDLGDLKVCKLPNGSKEFASKYLKKWKRKIEI
Download sequence
Identical sequences A0A0E2E883 K8Y6G2
WP_004489879.1.18456 WP_004489879.1.79523 WP_004489879.1.83002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]