SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0E2EF80 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0E2EF80
Domain Number 1 Region: 33-85,120-193
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 8.37e-20
Family SMI1/KNR4-like 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0E2EF80
Sequence length 195
Comment (tr|A0A0E2EF80|A0A0E2EF80_TREDN) Uncharacterized protein {ECO:0000313|EMBL:EMB46012.1} KW=Complete proteome OX=999426 OS=Treponema denticola AL-2. GN=HMPREF9730_01138 OC=Bacteria; Spirochaetes; Spirochaetales; Spirochaetaceae; Treponema.
Sequence
MQLIDKIKQIEKYLCEHFEEWDLDDPVEEGYLDDYQEISGASEEDLSAFEKKFGITLPED
FKELYRYKNGSKYLSIFPCVIDEIEMPFNLMSLQTVTKTKEHFQNRDALLSEFTDYFTNE
DIENMKDSRIKPYLFNKKWIPFAEYCDSCFLMLDFDPDTAGKEGQIICYIHDPDKVVYTA
PSITELVDGIIAEID
Download sequence
Identical sequences A0A0E2EF80
WP_002672550.1.77933

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]