SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0E2EFF0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A0E2EFF0
Domain Number - Region: 167-251
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.0785
Family SMI1/KNR4-like 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0E2EFF0
Sequence length 260
Comment (tr|A0A0E2EFF0|A0A0E2EFF0_TREDN) Uncharacterized protein {ECO:0000313|EMBL:EMB31569.1} KW=Complete proteome OX=999432 OS=Treponema denticola H-22. GN=HMPREF9726_01949 OC=Bacteria; Spirochaetes; Spirochaetales; Spirochaetaceae; Treponema.
Sequence
MKRLPLQNQIWRFIVEVIMETNNIINGLKHLSEGVFLPEEWIDWWKQNEKFAKQFLSPRW
YLKIKPKMSQGLMGAALISQNAARKYLKSINQSYNENSQVNYMEGWKKQIDDISLNYDKV
DIIDFDLKFTKLKQSYPNLFAVIKKHLLKSDVVENNLTEEKLTSSFFYKLLHSDVITFFY
CISQLKMEGILIDFDMLELREEYIKIGELWLNSDGDELYIRPYEASVYFHDIGKNQIHII
NKSFNLFIENDLSRFVYENA
Download sequence
Identical sequences A0A0E2EFF0
WP_002685277.1.67935

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]