SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0E2G925 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A0E2G925
Domain Number - Region: 14-54
Classification Level Classification E-value
Superfamily Sema domain 0.0745
Family Sema domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0E2G925
Sequence length 100
Comment (tr|A0A0E2G925|A0A0E2G925_ACINO) Uncharacterized protein {ECO:0000313|EMBL:ENV39706.1} KW=Complete proteome OX=1217985 OS=Acinetobacter nosocomialis NIPH 386. GN=F958_02733 OC=Acinetobacter calcoaceticus/baumannii complex.
Sequence
MSYKHNNLMAMRHRFWDEASDHVLNEKQFLQQTLIEQGIFNNATFDDVKYFFYTLPSIVI
VKAHALGFMHDSVKQMVIQHIQANRMHLMQKAELKIQFKM
Download sequence
Identical sequences A0A0E2G925 A0A2C9TCY4
HMPREF0014_03185T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]