SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0E2GLF9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A0E2GLF9
Domain Number - Region: 9-49
Classification Level Classification E-value
Superfamily Aspartate receptor, ligand-binding domain 0.0262
Family Aspartate receptor, ligand-binding domain 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0E2GLF9
Sequence length 73
Comment (tr|A0A0E2GLF9|A0A0E2GLF9_ACIRA) Uncharacterized protein {ECO:0000313|EMBL:ENV88686.1} KW=Complete proteome OX=981334 OS=Acinetobacter radioresistens DSM 6976 = NBRC 102413 = CIP 103788. GN=F939_01404 OC=Moraxellaceae; Acinetobacter.
Sequence
MKTVITVIAAVTVVSVGYITYHTIQQKRQQEIKQVIQEAQSSLEQAQHNPHHLERSTFPA
FDTAGKSVQTEKM
Download sequence
Identical sequences A0A0E2GLF9
WP_005025367.1.36433 WP_005025367.1.37436 WP_005025367.1.58587 WP_005025367.1.59622 WP_005025367.1.63088 WP_005025367.1.68439 WP_005025367.1.75658 WP_005025367.1.89497 WP_005025367.1.98847

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]