SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0E2MDH8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A0E2MDH8
Domain Number - Region: 5-53
Classification Level Classification E-value
Superfamily eIF2alpha middle domain-like 0.0589
Family eIF2alpha middle domain-like 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0E2MDH8
Sequence length 65
Comment (tr|A0A0E2MDH8|A0A0E2MDH8_LACCA) Uncharacterized protein {ECO:0000313|EMBL:ERN49762.1} KW=Complete proteome OX=1378069 OS=Lactobacillus casei 5b. GN=N422_06400 OC=Lactobacillus.
Sequence
MTKPSKEVEKIEQLLADPWAIDIQEIWEQAAHNPDPDKRKLFDAVHTYLLDKRQEKIINE
KHFVI
Download sequence
Identical sequences A0A0E2MDH8 A0A161XXH4 C2JSY7
WP_005693066.1.28125 WP_005693066.1.32073 WP_005693066.1.6012 WP_005693066.1.8164 WP_005693066.1.99959

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]