SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0E2MXV9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A0E2MXV9
Domain Number - Region: 110-213
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.000122
Family SMI1/KNR4-like 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0E2MXV9
Sequence length 218
Comment (tr|A0A0E2MXV9|A0A0E2MXV9_STAEP) Uncharacterized protein {ECO:0000313|EMBL:ESV19611.1} KW=Complete proteome OX=1344987 OS=Staphylococcus epidermidis WI09. GN=M464_0207050 OC=Staphylococcus.
Sequence
MDYLQYLKRFNKNIKILNENELEKISQRWKYIMLSENKLERVVEYWKEVLGGNLSNTIRY
IENHLIDIQFIKVNEDYYILYNILTENKEEGIYVGKIPNENKKISSIYDKLPNSLQTFYS
NLHDGFYYFASDSMGILELSMVKNLNEYDWAILEEIDEPKINLDTSYIIFDSGMGGFIVV
DVNKGIDDATIWFDDEAPMYQKNFWNFCDEWIKMGMEE
Download sequence
Identical sequences A0A0E2MXV9
WP_002486917.1.15840 WP_002486917.1.2088 WP_002486917.1.24406 WP_002486917.1.33011 WP_002486917.1.44114 WP_002486917.1.48318 WP_002486917.1.49813 WP_002486917.1.62700 WP_002486917.1.63535 WP_002486917.1.63865 WP_002486917.1.666 WP_002486917.1.74736

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]