SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0E2MZ30 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A0E2MZ30
Domain Number - Region: 110-212
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.0017
Family SMI1/KNR4-like 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0E2MZ30
Sequence length 218
Comment (tr|A0A0E2MZ30|A0A0E2MZ30_STAEP) Uncharacterized protein {ECO:0000313|EMBL:ESV19610.1} KW=Complete proteome OX=1344987 OS=Staphylococcus epidermidis WI09. GN=M464_0207045 OC=Staphylococcus.
Sequence
MGFLGEFQQFDPTFVYVENYDKANIPDKWKRVLSTKDKTKKVNLIIDIWKNGFSKKLSNV
LNYMSRNLIDCELIKNKDQYYIVYILQNPTNETIYYLGGLDSDNTNLEMLPNDLKKFYQE
IHNGFYFFPGKFMGLQEIKDVDVMSEYDWGVISDLDIHIDFDLDDYIIIFTTGMGGYIIV
KTYNDHSNAIIWFDDDEPIYDENIWGILDEWLYLGFTE
Download sequence
Identical sequences A0A0E2MZ30
WP_002486863.1.15840 WP_002486863.1.2088 WP_002486863.1.24406 WP_002486863.1.33011 WP_002486863.1.48318 WP_002486863.1.49813 WP_002486863.1.62700 WP_002486863.1.63535 WP_002486863.1.63865 WP_002486863.1.666 WP_002486863.1.70560 WP_002486863.1.74736

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]