SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0E2NX76 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A0E2NX76
Domain Number - Region: 33-105
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.0192
Family SMI1/KNR4-like 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0E2NX76
Sequence length 182
Comment (tr|A0A0E2NX76|A0A0E2NX76_9RHIZ) Uncharacterized protein {ECO:0000313|EMBL:ESX78539.1} KW=Complete proteome OX=1287287 OS=Mesorhizobium sp. LSHC414A00. GN=X757_09655 OC=Phyllobacteriaceae; Mesorhizobium.
Sequence
MLKKTHAVQFKGAVERQSEATEQVDNPGDVALVERGVPRSLVMRCPDGCGDILTVNLDRR
AGPAWRLYQREGGLTLFPSVWRDTGCGAHFIVWDNVIHWTNDAWILRRNSSLERAVEGRL
TDELASFVDIAAAVDELPWSVLDACRSLVNSGIAVEGTGAERSSFRLASDSVPTSRARKR
RW
Download sequence
Identical sequences A0A0E2NX76
WP_023724119.1.63321

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]