SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0E2P238 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0E2P238
Domain Number 1 Region: 4-94
Classification Level Classification E-value
Superfamily YccV-like 9.94e-36
Family YccV-like 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0E2P238
Sequence length 107
Comment (tr|A0A0E2P238|A0A0E2P238_9RHIZ) DNA-binding protein {ECO:0000313|EMBL:ESY20364.1} KW=Complete proteome OX=1287273 OS=Mesorhizobium sp. LNJC391B00. GN=X749_29415 OC=Phyllobacteriaceae; Mesorhizobium.
Sequence
MKTAKFSIGQVVRHRLFPFRGIIFDVDPQFANTDEWYEAIPADVRPRKDQPFYHLLAENS
ETEYIAYVSEQNLLEDQSGEPVRHPQIGEMFDKRPDGRYEPKRQSRH
Download sequence
Identical sequences A0A0E2NEV8 A0A0E2P238 V7EWD0 V7G2G5 V7H3J8 V7HFE0 X5PH75 X5QBT2 X5QPM0 X5S2N5 X5UNC3 X5VQK2 X5X3E3 X5XXV1 X5YDZ9 X5ZT74 X6AIZ5 X6C180 X6G7V9 X6I0S0 X6IIT3 X6J913 X6JT60 X6JXF7 X6K7D1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]