SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0E2P308 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A0E2P308
Domain Number - Region: 165-241
Classification Level Classification E-value
Superfamily P40 nucleoprotein 0.0654
Family P40 nucleoprotein 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0E2P308
Sequence length 268
Comment (tr|A0A0E2P308|A0A0E2P308_9STRE) Uncharacterized protein {ECO:0000313|EMBL:ETE03484.1} KW=Complete proteome OX=1415759 OS=Streptococcus pseudopneumoniae 22725. GN=U751_11205 OC=Streptococcus.
Sequence
MLSIDTQFVDTISKILSDYVSHSEITRMGEVLGYSQNDQNSGLNKHYRVHNIMSDILNKT
QDESNIKLVIEYICNPLRYIDKVSDFENLRLKLNVVLSLKGLAISDNGHVVITTASKTLV
EAKKRFESLDHMLRTLNVHPNVLKFCTQELLQENYFHAVFEASKGIFHRIRLLTGSSLDS
ASLIDQCFKIKEPVMIINGNKLQTLDEQSEYKGLKNLLLTIAHLYRNSKAHKLKYYNPDS
VNDALTALTLMSLAHNLLDNCTNTRRLD
Download sequence
Identical sequences A0A0E2P308
WP_023937574.1.24315 WP_023937574.1.49575

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]