SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0E2P5I1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0E2P5I1
Domain Number 1 Region: 129-268
Classification Level Classification E-value
Superfamily PAP/OAS1 substrate-binding domain 1.18e-49
Family AadK C-terminal domain-like 0.0000895
Further Details:      
 
Domain Number 2 Region: 1-123
Classification Level Classification E-value
Superfamily Nucleotidyltransferase 6.87e-35
Family AadK N-terminal domain-like 0.00052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0E2P5I1
Sequence length 275
Comment (tr|A0A0E2P5I1|A0A0E2P5I1_9STRE) Aminoglycoside 6-adenylyltransferase {ECO:0000313|EMBL:ETE05141.1} KW=Complete proteome OX=1415759 OS=Streptococcus pseudopneumoniae 22725. GN=U751_07110 OC=Streptococcus.
Sequence
MRIETEMLDLILQTAKTLQVKAIAMSGSRTDTKASKDELQDYDVVYIVDDLDNLTSDLSW
LAYFGERIIEQEVVLDHRRLYLMLFEDGNRIDLTLCPKNHIQEWVDSEAGFTVLEDPEHL
FEPYSQNLERYWTSPATETNFVKSCNEFWWVSAYVVKGICRKQVIYATYHLYGICQQALL
KVMAWQVVSDRGKVDIGKNYKYLFNYLPAEKEKKFLNLLDFSSLDKITHSLFATMQLFHK
EAQSLAQKLGFYYDKEVAEKMIEYAEERRCLNVVD
Download sequence
Identical sequences A0A0E2P5I1
WP_023936676.1.24315 WP_023936676.1.57772 WP_023936676.1.633

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]