SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0E2SXK8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A0E2SXK8
Domain Number - Region: 53-111
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.00432
Family SMI1/KNR4-like 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0E2SXK8
Sequence length 115
Comment (tr|A0A0E2SXK8|A0A0E2SXK8_BACFG) Uncharacterized protein {ECO:0000313|EMBL:EXZ79162.1} KW=Complete proteome OX=1339335 OS=Bacteroides fragilis str. 3-F-2 #6. GN=M144_1514 OC=Bacteroides.
Sequence
MKQKKRPASQTEAMKLRWKKRIVFEKGYTEMCAEWMAERLEALTDHLQYGHAAIAYQKQN
GDFRLVKATLIYYEAEFHKKYEPTKIEGAVVYWNVDEQRWTRFQVENFMEWRPIV
Download sequence
Identical sequences A0A0E2SXK8
WP_032581367.1.39779

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]