SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0E2TH35 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A0E2TH35
Domain Number - Region: 62-111
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.00902
Family SMI1/KNR4-like 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0E2TH35
Sequence length 115
Comment (tr|A0A0E2TH35|A0A0E2TH35_BACFG) Uncharacterized protein {ECO:0000313|EMBL:EXZ80046.1} KW=Complete proteome OX=1339335 OS=Bacteroides fragilis str. 3-F-2 #6. GN=M144_0768 OC=Bacteroides.
Sequence
MKKLKSPASQSEAMKLRWKKRIVFEKGYTESCAEWMAERLEALLDHMQYGHATVAYRKQN
GSFQLVKATLIYYEAEFRKKYDPAEVEGAVVYWNVDEQRWTTFQVENFMEWRPIA
Download sequence
Identical sequences A0A015ZWU6 A0A017NHY6 A0A0E2AU09 A0A0E2TH35
WP_005796181.1.10405 WP_005796181.1.11335 WP_005796181.1.39779 WP_005796181.1.43857 WP_005796181.1.7580 WP_005796181.1.81678 WP_005796181.1.87523 WP_005796181.1.88754 WP_005796181.1.89819

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]