SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0E2UH31 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0E2UH31
Domain Number 1 Region: 38-109
Classification Level Classification E-value
Superfamily Cytochrome b5-like heme/steroid binding domain 6.15e-16
Family Steroid-binding domain 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0E2UH31
Sequence length 119
Comment (tr|A0A0E2UH31|A0A0E2UH31_9STRE) Cytochrome b5 {ECO:0000313|EMBL:GAJ62329.1} KW=Complete proteome; Reference proteome OX=1348 OS=Streptococcus parauberis. GN=SS13_contig00020-0029 OC=Streptococcus.
Sequence
MKFRTIIIIVALSLILLILLIIFDPLNVNLKSNGLENTPNVVFTKTSLKEYDGIDGNKAY
IAVNGIVYDVTDINDWENGTHNGIKAGKDVTSEFEYSHHGKNVLNRLKKVGIYEERMNE
Download sequence
Identical sequences A0A0E2UH31
WP_004347224.1.24387 WP_004347224.1.56355 WP_004347224.1.91989

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]