SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0E2UXV7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0E2UXV7
Domain Number 1 Region: 21-137
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 1.96e-30
Family SMI1/KNR4-like 0.00033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0E2UXV7
Sequence length 140
Comment (tr|A0A0E2UXV7|A0A0E2UXV7_PSESF) Uncharacterized protein {ECO:0000313|EMBL:KCU99638.1} KW=Complete proteome OX=1194418 OS=Pseudomonas syringae pv. actinidiae ICMP 9617. GN=A250_02445 OC=Pseudomonadaceae; Pseudomonas; Pseudomonas syringae.
Sequence
MAACLHFIAWNKSALGLEQMTDNFFRTPTDAEIADAESKLNFRFPAPYVQFLKGGSDVVN
AVFEPAVILDGGSSLGIFEIAKIAWDHGVPRDWLPFIEDNGDYFCVSEAGGVRYWSHNGS
TNERWPTFSAWFRQVCIDLE
Download sequence
Identical sequences A0A0E2UXV7
WP_003379169.1.10813 WP_003379169.1.15376 WP_003379169.1.22256 WP_003379169.1.25447 WP_003379169.1.3107 WP_003379169.1.31627 WP_003379169.1.34243 WP_003379169.1.381 WP_003379169.1.45049 WP_003379169.1.51453 WP_003379169.1.53930 WP_003379169.1.54220 WP_003379169.1.6181 WP_003379169.1.69650 WP_003379169.1.80453 WP_003379169.1.82596 WP_003379169.1.93050

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]