SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0E2VNJ3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A0E2VNJ3
Domain Number - Region: 39-93
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.00149
Family SMI1/KNR4-like 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0E2VNJ3
Sequence length 150
Comment (tr|A0A0E2VNJ3|A0A0E2VNJ3_9FUSO) Uncharacterized protein {ECO:0000313|EMBL:KDE73773.1} KW=Complete proteome OX=1441737 OS=Fusobacterium necrophorum DJ-2. GN=FUSO8_00325 OC=Fusobacterium.
Sequence
MHNMLKIPSVIENFIKMKIHTKIPLLPCIYEDFEKMQIGYRWNPVQQCTLITNNTGSWQE
NWYVIAQNELGDPFFVDFATENYPVYTAIHGKGGWKAFKVSDSICQFTEILNKINNTDLT
FPCSLNFLNDIIDLKSEFWIEVNESCQEVE
Download sequence
Identical sequences A0A0E2VNJ3 A0A162INB9 H1D9D8
WP_005954725.1.1277 WP_005954725.1.16489 WP_005954725.1.18817 WP_005954725.1.31366 WP_005954725.1.33131 WP_005954725.1.41916 WP_005954725.1.46745 WP_005954725.1.69026 WP_005954725.1.74434 WP_005954725.1.91348 WP_005954725.1.9673

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]