SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0E2Z621 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0E2Z621
Domain Number 1 Region: 3-179
Classification Level Classification E-value
Superfamily TPR-like 7.96e-62
Family Atu0120-like 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0E2Z621
Sequence length 184
Comment (tr|A0A0E2Z621|A0A0E2Z621_9GAMM) Membrane protein {ECO:0000313|EMBL:KFI20884.1} KW=Complete proteome OX=314279 OS=Nitrosococcus oceani C-27. GN=IB75_00465 OC=Chromatiaceae; Nitrosococcus.
Sequence
MLLNSMHHQQIIDFWFKEIKPESWWKKIPHFDQLIKERFKAHHRAAVQGELYEWRREPFG
RLAEIIILDQFSRNIYRNHPLSFAYDTAALILSQEAIDKNVGKMLNSEHKIFLYMPFMHS
ESLKIHQIGIKLFAEPGLESQYDCEIKHQAIITRFGRYPHRNQILERPSTPAEIAFLKKA
DSSF
Download sequence
Identical sequences A0A0E2Z621 Q3JEV7
323261.Noc_0106 WP_002812165.1.20919 WP_002812165.1.77844 WP_002812165.1.91979 gi|77163644|ref|YP_342169.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]