SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0E2ZF94 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0E2ZF94
Domain Number 1 Region: 11-44
Classification Level Classification E-value
Superfamily Rubredoxin-like 0.000053
Family Rubredoxin 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0E2ZF94
Sequence length 72
Comment (tr|A0A0E2ZF94|A0A0E2ZF94_BIFBI) Putative regulatory protein {ECO:0000313|EMBL:ALE12059.1} KW=Complete proteome OX=1681 OS=Bifidobacterium bifidum. GN=A0008_0231 OC=Bifidobacterium.
Sequence
MSFDQGGTVPTYHYRCKNCGYDFTEQQSFEDDPITVCPQCGQEQVRKVYSAVPIEFKGHG
FYRTDGRGGSGK
Download sequence
Identical sequences A0A0E2ZF94 A0A0H2P9G8 E3EMJ5 E4VBK2 R6GF75 U2BWE1
gi|310288049|ref|YP_003939308.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]