SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0E3CSS3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0E3CSS3
Domain Number 1 Region: 5-143
Classification Level Classification E-value
Superfamily Ribosomal protein L13 8.11e-56
Family Ribosomal protein L13 0.00000635
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0E3CSS3
Sequence length 145
Comment (tr|A0A0E3CSS3|A0A0E3CSS3_STASA) 50S ribosomal protein L13 {ECO:0000256|HAMAP-Rule:MF_01366, ECO:0000256|RuleBase:RU003878, ECO:0000256|SAAS:SAAS00725370} KW=Complete proteome OX=29385 OS=Staphylococcus saprophyticus. GN=SE00_12660 OC=Staphylococcus.
Sequence
MRQTFMANESNIERKWYVIDAEGKTFGRLSSEVAAILRGKNKVTYTPHVDTGDYVIVINA
SKIHFTGNKERDKMYYRHSNHPGGIKSISAGELKANNPERLLENSIKGMLPSTRLGEKQG
KKLFVYGGAEHPHAAQQPENYELRG
Download sequence
Identical sequences A0A0E3CSS3
WP_002482643.1.15358 WP_002482643.1.38289 WP_002482643.1.48390 WP_002482643.1.53552 WP_002482643.1.54785 WP_002482643.1.63267

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]