SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0E3JZA5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0E3JZA5
Domain Number 1 Region: 45-197
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 4.32e-16
Family SMI1/KNR4-like 0.009
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0E3JZA5
Sequence length 204
Comment (tr|A0A0E3JZA5|A0A0E3JZA5_CLOSL) Uncharacterized protein {ECO:0000313|EMBL:AKA68089.1} KW=Complete proteome OX=1548 OS=Clostridium scatologenes. GN=CSCA_0964 OC=Clostridium.
Sequence
MIKEENEVIKKYFEILSKNHPEKFEIEEMFDDGECIVPENMKDSNDANKWVLLESNVSEE
DIFKLEKKINIKLPLIYKAFISTYFHMFKELDGVLNDFHCEDGKEVYVDIFRQPSNKPLQ
VIENVYKECEEIIEFGYIPIGDFNGWGPLCFDTHNNYKLVWLDHEEYYSCETREELEELE
ETIFDNFKDFLECFFVGVTHKCEM
Download sequence
Identical sequences A0A0E3JZA5
WP_029159586.1.44790

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]