SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0E3MJL6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0E3MJL6
Domain Number 1 Region: 238-411
Classification Level Classification E-value
Superfamily PAP/Archaeal CCA-adding enzyme, C-terminal domain 1.18e-42
Family Archaeal tRNA CCA-adding enzyme 0.0041
Further Details:      
 
Domain Number 2 Region: 142-253
Classification Level Classification E-value
Superfamily PAP/OAS1 substrate-binding domain 2.01e-40
Family Archaeal tRNA CCA-adding enzyme substrate-binding domain 0.00017
Further Details:      
 
Domain Number 3 Region: 4-182
Classification Level Classification E-value
Superfamily Nucleotidyltransferase 6.54e-32
Family Archaeal tRNA CCA-adding enzyme catalytic domain 0.00024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0E3MJL6
Sequence length 412
Comment (tr|A0A0E3MJL6|A0A0E3MJL6_SULSF) tRNA-NT {ECO:0000256|HAMAP-Rule:MF_01264} KW=Complete proteome OX=2287 OS=Sulfolobus solfataricus. GN=SSOP1_1066 OC=Sulfolobus.
Sequence
MIEEEVLKIIKPTEEDKKGIEKVLEIIRERLNKLDFEVEGSFRKGTWLRQDTDIDVFVFY
PKDVGKEYLERNALNDIINRIKDLDYTLAYAEHPYVIVNINNVEVDIVPALRVESGDKAI
TAVDRTPFHTKYVTSHLDERGKDEVRLLKRFMKGIGVYGAELKVQGFSGYATELLIIYYG
NFRKVLEEASKWKHPIKIELTKPMKIFSEPLIIPDPVDPKRNVTAAVSLKNIATFSIAAK
YYLKNPSIEFFFPSKKVEEKVKGDVLILRLNLDEKSSEDIVWGQIKRSVNKIERALKQYG
FRVIDVQAWGDTNNITIAVQLESKNIGQYYLNIGPQYYSGTIEDFIQKNDNIWVGEDGRL
YSIKERKEYDAETIAKKNIVLKVKYNIESYWLQNTEDQQIMKFLRKTPTWLK
Download sequence
Identical sequences A0A0E3MJL6 D0KTZ9 Q97Z92
gi|384434461|ref|YP_005643819.1| gi|15897906|ref|NP_342511.1| WP_009989193.1.14611 WP_009989193.1.22626 WP_009989193.1.43719 WP_009989193.1.57434 WP_009989193.1.66040 WP_009989193.1.8449 WP_009989193.1.93834 273057.SSO1039

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]