SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0E3N2N6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0E3N2N6
Domain Number 1 Region: 11-96
Classification Level Classification E-value
Superfamily Snake toxin-like 0.00000000953
Family Extracellular domain of cell surface receptors 0.064
Further Details:      
 
Domain Number 2 Region: 107-175
Classification Level Classification E-value
Superfamily Snake toxin-like 0.0000000253
Family Extracellular domain of cell surface receptors 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0E3N2N6
Sequence length 190
Comment (tr|A0A0E3N2N6|A0A0E3N2N6_NOTVI) Sodefrin-like factor {ECO:0000313|EMBL:AKA95481.1} OX=8316 OS=Notophthalmus viridescens (Eastern newt) (Triturus viridescens). GN=SPF OC=Pleurodelinae; Notophthalmus.
Sequence
LQALITGADCLLCEQCFAVGTSQCSGIFKQCSPYISHCVKGMENNTVGTHVILTAFKDCL
DPSEKAACGREVFLKNSVFFSQTSRTCCDSDFCNRGDVEVPEVDETPNGYKCEDCFSDQS
TDPCTATGQVQCTGEQNTCVSFSGTASRPGEAVKQYSMKGCASRDFCDLFYLSATQAHTY
DLLCSPAEKL
Download sequence
Identical sequences A0A0E3N2N6

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]