SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0E3NTY1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0E3NTY1
Domain Number 1 Region: 2-137
Classification Level Classification E-value
Superfamily N-terminal domain of eukaryotic peptide chain release factor subunit 1, ERF1 5.75e-50
Family N-terminal domain of eukaryotic peptide chain release factor subunit 1, ERF1 0.00014
Further Details:      
 
Domain Number 2 Region: 139-270
Classification Level Classification E-value
Superfamily Translational machinery components 7.41e-41
Family ERF1/Dom34 middle domain-like 0.00049
Further Details:      
 
Domain Number 3 Region: 273-414
Classification Level Classification E-value
Superfamily L30e-like 1.04e-37
Family ERF1/Dom34 C-terminal domain-like 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0E3NTY1
Sequence length 415
Comment (tr|A0A0E3NTY1|A0A0E3NTY1_9EURY) Translation termination factor aRF1 {ECO:0000256|HAMAP-Rule:MF_00424} KW=Complete proteome OX=1434102 OS=Methanosarcina sp. WH1. GN=MSWH1_3164 OC=Methanosarcinaceae; Methanosarcina.
Sequence
MTEQSAHEKYEFKKKLEGLRNKRGRSTELISLYIPADKQIFDVTNQLKDEHGQAANIKSK
LTRTNVQGAIESLLSRLRYLDKVPENGVVYFTGAVDIGANKTNMESEVIVPPDPITVYKY
HCDSSFYLEPLEDMLKDKNTYGLLVLDRREATVGLLVGKRIQAFRNLTSTVPGKQRKGGQ
SAHRFQQLRLIAIHEFYKRIGDAASEIFMGVDHKDLKGVLIGGPSPTKEEFYAGDFLHHE
LLKKIIGLFDTAYTDESGLSELVNAAGEKLQDLELTGQKNAVRSFFKELISDSGKVAYGE
AQVRANLEINSVDVLLLSEDLRAERVTTKCSVCEYENKWTRRWKPGEPAPTAGNCPKCGS
SLEVTDVTDVVDEFSELADKSNAKVFFVSTDFDEGSQLMNAFGGIAAILRYNTGI
Download sequence
Identical sequences A0A0E3KVZ9 A0A0E3NTY1
WP_048130089.1.35945 WP_048130089.1.44353

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]