SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0E3P8S8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0E3P8S8
Domain Number 1 Region: 53-141
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 3.24e-19
Family Cold shock DNA-binding domain-like 0.00098
Further Details:      
 
Domain Number 2 Region: 138-215
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.96e-16
Family Eukaryotic type KH-domain (KH-domain type I) 0.00026
Further Details:      
 
Domain Number 3 Region: 2-52
Classification Level Classification E-value
Superfamily Ribosomal L27 protein-like 0.00000000000314
Family ECR1 N-terminal domain-like 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0E3P8S8
Sequence length 260
Comment (tr|A0A0E3P8S8|A0A0E3P8S8_9EURY) Exosome complex component Rrp4 {ECO:0000256|HAMAP-Rule:MF_00623} KW=Complete proteome OX=1434120 OS=Methanosarcina siciliae T4/M. GN=MSSIT_2690 OC=Methanosarcinaceae; Methanosarcina.
Sequence
MDKKIVIPGDLLSENQKKAGYGTYIKNDKIYSSLCGIENLKEDKVGVIPLAGAYIPSAND
VVIGIVIVVTPSNWIFDIAAPYDGLLHVSEYPRRVESREMPEILGVGDSVILRVKDVDSS
MKVELALRDPSLHKLKTGQIIKVESVKVPRVIGHGGSMISMLKKETNCSIFVGQNGRIWI
DGKDEDIELLSKALRKIEIEAQRSGLTDRIYNFLKNERIRQKESKPVEFFKKETEGVTAT
KEDHSEEIYRKIDVLLDPKN
Download sequence
Identical sequences A0A0E3P8S8 A0A0E3PG73 A0A0E3PS36
WP_048173215.1.11460 WP_048173215.1.43275

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]