SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0E3PTU7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0E3PTU7
Domain Number 1 Region: 2-117
Classification Level Classification E-value
Superfamily CobE/GbiG C-terminal domain-like 2.88e-31
Family CobE/GbiG C-terminal domain-like 0.00032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0E3PTU7
Sequence length 117
Comment (tr|A0A0E3PTU7|A0A0E3PTU7_9EURY) Cobalamin biosynthesis protein CbiG {ECO:0000313|EMBL:AKB38415.1} KW=Complete proteome OX=1434118 OS=Methanosarcina siciliae C2J. GN=MSSAC_3825 OC=Methanosarcinaceae; Methanosarcina.
Sequence
MILGIGTRRGITNEEVLDAVKQALDECGLSLQEITAFASAKLKENERGLLEACEILGIPV
NFLPDEVLNSYNPPSSSQASRFGLKGVAEPAALALSEKHELICRKKVYGRVTIAIAR
Download sequence
Identical sequences A0A0E3PAA9 A0A0E3PGY0 A0A0E3PTU7
WP_048173875.1.11460 WP_048173875.1.43275

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]