SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0E3Q0E3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0E3Q0E3
Domain Number 1 Region: 7-146
Classification Level Classification E-value
Superfamily MTH1598-like 2.88e-46
Family MTH1598-like 0.0000924
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0E3Q0E3
Sequence length 146
Comment (tr|A0A0E3Q0E3|A0A0E3Q0E3_9EURY) Protein archease {ECO:0000256|HAMAP-Rule:MF_01222} KW=Complete proteome OX=1434123 OS=Methanosarcina vacuolata Z-761. GN=MSVAZ_0295 OC=Methanosarcinaceae; Methanosarcina.
Sequence
MSSQGKQYEYLDHTADIKFQAYGKTREEVFENAALAMFNVIIDTGKISGDTAREIFLKSP
DLESLLVDWLSELLYLFEVDEIVFREFRVEKIREEKGEYSITAQALGKKYYLEKLPFETE
IKAVTYNQLEITKTADGWKAQVVVDI
Download sequence
Identical sequences A0A0E3Q0E3 A0A0E3QAD7
WP_048117194.1.42324 WP_048117194.1.64521

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]