SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0E3Q3F0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0E3Q3F0
Domain Number 1 Region: 168-298
Classification Level Classification E-value
Superfamily Translational machinery components 3.53e-28
Family ERF1/Dom34 middle domain-like 0.013
Further Details:      
 
Domain Number 2 Region: 63-165
Classification Level Classification E-value
Superfamily N-terminal domain of eukaryotic peptide chain release factor subunit 1, ERF1 0.0000248
Family N-terminal domain of eukaryotic peptide chain release factor subunit 1, ERF1 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0E3Q3F0
Sequence length 298
Comment (tr|A0A0E3Q3F0|A0A0E3Q3F0_9EURY) Uncharacterized protein {ECO:0000313|EMBL:AKB43870.1} KW=Complete proteome OX=1434123 OS=Methanosarcina vacuolata Z-761. GN=MSVAZ_1601 OC=Methanosarcinaceae; Methanosarcina.
Sequence
MQSAKNQLEKKDILARQAVSDRQEAEALLNQERIRTRTISHELETIRAESQSKLKFRGIE
TLSLQAIQAYLSKLKSFHAPADDLLTAYLPSGTRLSGVISEKVLERVEEENLTLLDRLET
ETGIVLFYDIHRMICEAIAPSFPVTSSSWQLGDSFEVSLLEEILNKDYRMLVLVLHAGES
FIGFAPDARVFDTEELIRSSVKEKHSKGGFSQRRFERLREEDIAHHMDKVIEALDRVLEE
NKLIDCVILSGDFQLIGEIRKRLPFNLEIIEKPSDIRVEKSGGEEILRTVLSSRRYLL
Download sequence
Identical sequences A0A0E3Q3F0
WP_048120180.1.64521

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]