SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0E3R4M3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0E3R4M3
Domain Number 1 Region: 120-258
Classification Level Classification E-value
Superfamily N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE) 7.85e-26
Family N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE) 0.00092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0E3R4M3
Sequence length 268
Comment (tr|A0A0E3R4M3|A0A0E3R4M3_METBA) Circadian phase modifier {ECO:0000313|EMBL:AKB58612.1} KW=Complete proteome OX=1434106 OS=Methanosarcina barkeri 227. GN=MSBR2_2096 OC=Methanosarcinaceae; Methanosarcina.
Sequence
MDLTDILKAVKDGKMDLETAEKQARGLGFVSYMDIAKLDSHRKSRTGVIEAILADCKDPD
DVVEIARVMVAESKRALITRVSPGHLEALKQAFDHDKLEWNSRARTVVIHDGTPAPRTGG
VVGFVSAGTADIPAAEEARVVASEMGCETVAVYDVGVAGIHRLIPALDKLKARMPGAIVV
AAGREGTLPTIVSGLVDVPVIGLPVSTGYGAGGGGKAALLAMLQSCSTLAVVNIDAGFVA
GAYAARIANMIAAAYTHGKEDRAEQTRE
Download sequence
Identical sequences A0A0E3QS76 A0A0E3R4M3 A0A0G3CBN9 A0A1D2WW83
WP_048120398.1.13151 WP_048120398.1.22081 WP_048120398.1.33551 WP_048120398.1.38397

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]