SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0E3RDC9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0E3RDC9
Domain Number 1 Region: 2-159
Classification Level Classification E-value
Superfamily MgtE membrane domain-like 7.32e-23
Family MgtE membrane domain-like 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0E3RDC9
Sequence length 163
Comment (tr|A0A0E3RDC9|A0A0E3RDC9_METMZ) Mg/Co/Ni transporter MgtE {ECO:0000313|EMBL:AKB62157.1} KW=Complete proteome OX=1434115 OS=Methanosarcina mazei SarPi. GN=MSMAP_2172 OC=Methanosarcinaceae; Methanosarcina.
Sequence
MGIIVGQILNTRENSLLSMPAILILIPSLVKIGGDTGSMLGARLSSAFHMGLGDRIYRNP
VVHNSVIAAAIVGFVSSIFVSMLVFLASKLMGFGMPFITLLGISLIAVVIELTVVYSATV
AIAFASHRFGMDPDDTVIPFIASLGDLVGVIGIFIALHLLNIL
Download sequence
Identical sequences A0A0E3LUL7 A0A0E3RDC9 A0A0E3WPI3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]