SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0E3RH72 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A0E3RH72
Domain Number - Region: 108-166
Classification Level Classification E-value
Superfamily Collagen-binding domain 0.0379
Family Collagen-binding domain 0.0097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0E3RH72
Sequence length 229
Comment (tr|A0A0E3RH72|A0A0E3RH72_METMZ) Uncharacterized protein {ECO:0000313|EMBL:AKB64273.1} KW=Complete proteome OX=213585 OS=Methanosarcina mazei S-6. GN=MSMAS_1077 OC=Methanosarcinaceae; Methanosarcina.
Sequence
MKTRSASITLVLLLTIGVITAVSFSLGCTEQEETPAEPSDNTPVEPVESAPAEPADNDSV
DAPAETEEETSAEPVENTPVESAGVVPEESSGSPESSGVDIEDLEPISAGNIQDTEWQWT
GFQDSDSPDSQIKVPSPEDYTLSFFADGTYYIKADCNTGSGTYSLEGNRLFLDLPVTTLV
DCGPESMNGEYMSLLPTVEAAAIEDGQLVLYPGNEGDKMFFINGGKAER
Download sequence
Identical sequences A0A0E3RH72 A0A0E3RPG9 Q8Q0B4
WP_011032177.1.23878 WP_011032177.1.49674 WP_011032177.1.82674 WP_011032177.1.90340 192952.MM_0223 gi|21226325|ref|NP_632247.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]