SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0E3RRC3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0E3RRC3
Domain Number 1 Region: 8-187
Classification Level Classification E-value
Superfamily MgtE membrane domain-like 3.27e-29
Family MgtE membrane domain-like 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0E3RRC3
Sequence length 190
Comment (tr|A0A0E3RRC3|A0A0E3RRC3_METMZ) Mg/Co/Ni transporter MgtE {ECO:0000313|EMBL:AKB69356.1} KW=Complete proteome OX=1434114 OS=Methanosarcina mazei LYC. GN=MSMAL_2813 OC=Methanosarcinaceae; Methanosarcina.
Sequence
MYLSEYASISSIVREALPFELLATVGGVIAGIILSKMTNELEMIPGLLVIYPGVLGLRGN
ISSTLGSRLGSAIHMGLITDIDRNNPELVNNISGSLLLGFIMAILLGVLGHFVTLALGFE
SAGIFKLILICAISALTSGVILSFVAVLLAIGTFRFGFDPDNVVTPSIATIGDIVSMLML
FLSAKLVVML
Download sequence
Identical sequences A0A0E3RGX0 A0A0E3RRC3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]