SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0E3UGE4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0E3UGE4
Domain Number 1 Region: 299-350,439-689
Classification Level Classification E-value
Superfamily Ankyrin repeat 3.34e-33
Family Ankyrin repeat 0.0014
Further Details:      
 
Domain Number 2 Region: 36-109,140-196
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.000000873
Family SMI1/KNR4-like 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0E3UGE4
Sequence length 702
Comment (tr|A0A0E3UGE4|A0A0E3UGE4_XANCA) Uncharacterized protein {ECO:0000313|EMBL:AKC80745.1} KW=Complete proteome OX=339 OS=Xanthomonas campestris. GN=XB05_19955 OC=Xanthomonadaceae; Xanthomonas.
Sequence
MLGACATQDSALHTRWSQWQAKWRWMEAIARKRRWQVTPLRIAPPATERQLLSLERRHRL
PIPAQLRRVLRELSAEVSFGWYVPSHLRAMEQQDLPSMSCNRDTVWSLTHIDTMALPVFL
DWKQELATRDLSEAPNSPALWEHQFAFYNLINGDWLTIDTTHADPARQPVRYFSHELEML
HGLALAPDFFSFITQMSALGMAGTEWASWMRFGNGQKNDTFYLDAGNEGAKAWLAWLQRD
PAQPGPDTPPLPIVERSAADRALLDAARANSLVGVEAALLAGAVPDCTPDSDWLMEHTAS
DQEFFTAIHYATRHDNTAMIERLLKAGATLNTRLLPLNTAVKHGKLATVRWLIAHGARVN
GWANQRYWPLHDLVVTRGPIAAMTRAHYRQHLIDSISIGSLDSLDDMIAQAKDAQTRARY
RAAKRALQQASEEAVKDVDSKLRNHLSLQAYLDMLEALLDAGADPDARWDNGTTMLGWGG
VATARVLLAHGADPNARDIHGTTPLHTASTGEKVRVLVAGGADINAQAIAQNTDDSQHYT
PLQSALLSHTLDGDSPITALLELGADATRTDADGRSSLAYCFQPDLVRLIMSKGLDPLAL
QPGQQTLLHNLTARHWLPRHTFPKEVAFLDFLLSLGIDINARDARGRTLLHYAAEQESND
ESAPNYALVLARGADKTIKDNDGKRAVDLFAASLQTVRAALR
Download sequence
Identical sequences A0A0E3UGE4
WP_046345593.1.53125

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]