SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0E3VEZ8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0E3VEZ8
Domain Number 1 Region: 88-213
Classification Level Classification E-value
Superfamily Cyclophilin-like 4.55e-46
Family PH0987 C-terminal domain-like 0.0000111
Further Details:      
 
Domain Number 2 Region: 5-92
Classification Level Classification E-value
Superfamily PH0987 N-terminal domain-like 6.02e-16
Family PH0987 N-terminal domain-like 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0E3VEZ8
Sequence length 218
Comment (tr|A0A0E3VEZ8|A0A0E3VEZ8_BURCE) Allophanate hydrolase {ECO:0000313|EMBL:AKE02468.1} KW=Complete proteome OX=292 OS=Burkholderia cepacia (Pseudomonas cepacia). GN=XM57_05605 OC=Burkholderiaceae; Burkholderia; Burkholderia cepacia complex.
Sequence
MTQPRIFPFGDTALVCEVPPPATLDCQRRVWAVAAAARAWPDVVDVVPGMNNLTIVFDAL
ATSADSLIPALRDAWDSADVEHADGRDVEIPVQYGGAAGPDLQAVAAHTGLSADEVVARH
AAGEYVVFFLGFQPGFAYLGGLDASLHTPRRAAPRLEVPAGSVGIGGAQTGIYPTTSPGG
WQLIGRTSQVLFDPSRPQPTLLLPGDRVRFTIAGVDAT
Download sequence
Identical sequences A0A0E3VEZ8 A2W6S1
WP_006763162.1.3886 WP_006763162.1.58874 WP_006763162.1.60412 WP_006763162.1.67275

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]