SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0E3VHL5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0E3VHL5
Domain Number 1 Region: 123-235
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.0000222
Family SMI1/KNR4-like 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0E3VHL5
Sequence length 241
Comment (tr|A0A0E3VHL5|A0A0E3VHL5_BURCE) Uncharacterized protein {ECO:0000313|EMBL:AKE07053.1} KW=Complete proteome OX=292 OS=Burkholderia cepacia (Pseudomonas cepacia). GN=XM57_27815 OC=Burkholderiaceae; Burkholderia; Burkholderia cepacia complex.
Sequence
MIELSATAYAAELQRFKLRGRVWLASKDIPADVQVPTAWRALLDMRDAALETSLAKMWAG
VVDRLPAVRQFFDEKLRRPAVLQKENGDLCLLYPYTVDHDDLNFFIGHPPLGDLVSDDMP
LWRALPDDLRSFYQLAHNGWTFFPANSMGPLPIGDQTALTAKLDLTPDETRALGVNPDLV
WTVFQNGGGDYLCLDLRDSAGDGSAAGRIWWHDNPAELEPVDFWAVMNAWFEIFVEDADR
R
Download sequence
Identical sequences A0A0D5IV90 A0A0E3VHL5

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]