SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0E3ZUW0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0E3ZUW0
Domain Number 1 Region: 6-129
Classification Level Classification E-value
Superfamily Transcription factor NusA, N-terminal domain 1.83e-30
Family Transcription factor NusA, N-terminal domain 0.00024
Further Details:      
 
Domain Number 2 Region: 204-282
Classification Level Classification E-value
Superfamily Prokaryotic type KH domain (KH-domain type II) 3.92e-29
Family Prokaryotic type KH domain (KH-domain type II) 0.0002
Further Details:      
 
Domain Number 3 Region: 284-347
Classification Level Classification E-value
Superfamily Prokaryotic type KH domain (KH-domain type II) 0.00000000000828
Family Prokaryotic type KH domain (KH-domain type II) 0.00068
Further Details:      
 
Domain Number 4 Region: 135-203
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.000000000111
Family Cold shock DNA-binding domain-like 0.011
Further Details:      
 
Domain Number 5 Region: 357-409
Classification Level Classification E-value
Superfamily Rad51 N-terminal domain-like 0.0000121
Family DNA repair protein Rad51, N-terminal domain 0.053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0E3ZUW0
Sequence length 414
Comment (tr|A0A0E3ZUW0|A0A0E3ZUW0_9BACT) Transcription termination/antitermination protein NusA {ECO:0000256|HAMAP-Rule:MF_00945} KW=Complete proteome; Reference proteome OX=1379870 OS=Spirosoma radiotolerans. GN=SD10_07440 OC=Spirosoma.
Sequence
MTSGLLIESFADFARSKNIDRPTMITILEDVFRTMIRKKYGTDENFDVIINAESGDLEMW
RTREIVDDDSEDIWDYDKIPLAEARKIQDDFEVGEQVAEEVKLDDFGRRVVQTARQTLIQ
KIKDMEKELLYQKYKDQVGDLVGAEVYQLLKHEIILVDSENNELSLPRTEQIPKDRYRKG
EAVKAVISRVDMLNGTPKIILSRTSPVFLERLFEIEVPEIYDGLISIRKIVREPGERAKV
AVESYDDRIDPVGACVGMKGSRIHGIVRELGNENIDVINYTENLELLISRALSPAKISSM
QIDRETKRVSVFLKPDQVSLAIGKGGQNIKLAGRLVDMEIDVFRDNEGQEDDEDVDLMEF
SDEIDEWMIQELRKVGLDTAKSVLALNKEELVRRTDLEEDTVEEILNILKQEFE
Download sequence
Identical sequences A0A0E3ZUW0
WP_046376364.1.5798

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]