SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0E4BHL2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0E4BHL2
Domain Number 1 Region: 7-114
Classification Level Classification E-value
Superfamily N-utilization substance G protein NusG, N-terminal domain 1.83e-26
Family N-utilization substance G protein NusG, N-terminal domain 0.0005
Further Details:      
 
Domain Number 2 Region: 124-179
Classification Level Classification E-value
Superfamily Translation proteins SH3-like domain 8.17e-18
Family N-utilization substance G protein NusG, C-terminal domain 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0E4BHL2
Sequence length 180
Comment (tr|A0A0E4BHL2|A0A0E4BHL2_TANFO) Transcription termination/antitermination protein NusG {ECO:0000256|HAMAP-Rule:MF_00948, ECO:0000256|RuleBase:RU000538, ECO:0000256|SAAS:SAAS00126873} KW=Complete proteome OX=1307833 OS=Tannerella forsythia KS16. GN=TFKS16_1728 OC=Tannerella.
Sequence
MSDSQQKFYVLRAISGKENKVREYLEAEMRNSDLGNYVSQVLIPTEKTFTMRNGKKVVKE
RAYLPGYVLVEANLVGEVIHRLREIPNVIGFLGGVEHPIPLRPSEVSRVLGTLDELQEQP
EELDVQYDVGETVKVTYGPFNGFSGIIEEVNAEKKKLKVIVKIFGRKTPLELSYVQVEKE
Download sequence
Identical sequences A0A0E4BHL2 A0A1D3UQ26 G8UPP8
WP_014225271.1.25503 WP_014225271.1.2993 WP_014225271.1.32324 WP_014225271.1.3766 WP_014225271.1.52736 WP_014225271.1.76598 WP_014225271.1.98790 gi|375255638|ref|YP_005014805.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]