SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0E4GA53 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0E4GA53
Domain Number 1 Region: 3-134
Classification Level Classification E-value
Superfamily Ferritin-like 6.32e-44
Family Ferritin 0.0000218
Further Details:      
 
Domain Number 2 Region: 137-178
Classification Level Classification E-value
Superfamily Rubredoxin-like 0.00000000000526
Family Rubredoxin 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0E4GA53
Sequence length 179
Comment (tr|A0A0E4GA53|A0A0E4GA53_9FIRM) Rubrerythrin {ECO:0000313|EMBL:CFX22868.1} KW=Complete proteome; Reference proteome OX=690567 OS=Syntrophomonas zehnderi OL-4. GN=15 OC=Syntrophomonas.
Sequence
MSLKGSKTEENLWKAFAGESQARNKYTFWASQARKEGYEQIAGFFEETADNEKEHAKRLY
KFLVGGLIPPTSENLEAAAQGENEEHTSMYPEMEKVAREEGFNEIADVFREIAEVEEAHE
KRFRKLLDNVQRNTVFKKPAPVKWKCRNCGYIHEGTEPPEKCPACDHPRSYYEVLAENY
Download sequence
Identical sequences A0A0E4GA53
WP_084691472.1.5331

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]