SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0E4GW17 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0E4GW17
Domain Number 1 Region: 4-163
Classification Level Classification E-value
Superfamily N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE) 3.27e-66
Family N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE) 0.00000249
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0E4GW17
Sequence length 170
Comment (tr|A0A0E4GW17|A0A0E4GW17_9MYCO) 5-(carboxyamino)imidazole ribonucleotide mutase {ECO:0000256|HAMAP-Rule:MF_01929} KW=Complete proteome OX=141349 OS=Mycobacterium lentiflavum. GN=BN1232_01407 OC=Mycobacterium.
Sequence
MSEPRVGVIMGSDSDWSVMADAAAALAEFDIPAEVRVVSAHRTPGVMFDYARGAADRGIE
VIIAGAGGAAHLPGMVASATPLPVIGVPVPLGRLDGMDSLLSIVQMPAGVPVATVSIGGA
RNAGLLAVRILGSSDPALRARIVAFQEQLADSVRAKDEALQELQGKVTDE
Download sequence
Identical sequences A0A0E4GW17
WP_090600708.1.82773

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]