SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0E8TLB2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0E8TLB2
Domain Number 1 Region: 11-145
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 2.49e-19
Family SMI1/KNR4-like 0.0076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0E8TLB2
Sequence length 150
Comment (tr|A0A0E8TLB2|A0A0E8TLB2_STREE) SMI1 / KNR4 family {ECO:0000313|EMBL:CRG02498.1} KW=Complete proteome OX=1313 OS=Streptococcus pneumoniae. GN=ERS020526_05883 OC=Streptococcus.
Sequence
MWKNLILEIEKIEKSFNDKLNTPATDSEVKKLRERMKKSFNVDLPSEYEEFLKTVNGLDF
NGLVLYGVDSYLLDTERDESICGLIETNEIWYENEFQKEYLFLGDSNIAWFCKNLSDGTY
LELDKPSGTVMNTYNDCNTMLEEALKTALL
Download sequence
Identical sequences A0A0E8TLB2 A0A193CP61 A0A1G1UMY2 A0A243IMM8 A0A2B2X778 B5UK01 C2WIL3 C2X7X1 J7Z690
WP_000265786.1.101224 WP_000265786.1.12553 WP_000265786.1.24795 WP_000265786.1.31221 WP_000265786.1.40034 WP_000265786.1.44348 WP_000265786.1.47437 WP_000265786.1.55077 WP_000265786.1.57732 WP_000265786.1.6475 WP_000265786.1.6816 WP_000265786.1.71242 WP_000265786.1.81570 WP_000265786.1.86374 WP_000265786.1.87947 WP_000265786.1.88269 WP_000265786.1.90254

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]